Agiùtto dAPI MediaWiki
Sta chi a l'é 'na pàgina de docomentaçión de API MediaWiki outogenerâ.
Docomentaçión e ezénpiː https://www.mediawiki.org/wiki/Special:MyLanguage/API:Main_page
informazioni generali
- Doocomentaçión (in ingléize)
- Etiquette & lìnie goìdda in sce l'utilìzzo
- FAQ (in ingléize)
- Mailing list
- Anónçi in sce l'API
- Bug & domànde
Stâto: l'API MediaWiki a l'é 'n'interfàccia méuia e stàbile ch'a l'é ativaménte suportâ e megioâ. Scibén che amiémmo de evitâlo, poriêscimo dovéi fâ de modìfiche che càozan di fonçionâ mâ; inscrîvise a-a mailing list in scî anónçi de l'API MediaWiki pe êse informòu in scî agiornaménti.
Instruçioìn eræ: quànde són dæte a-e API de instruçioìn eræ, 'n'intestaçión HTTP a saiâ mandâ co-o mesàggio "MediaWiki-API-Error" e, ségge o valô de l'intestaçión, ségge o còdice d'erô, saiàn inpòstæ co-o mæximo valô. Pe ciù informaçioìn, lêze API:Eroî e avertiménti (in ingléize).
Test: pe provâ façilménte e domànde API, védde Special:ApiSandbox.
Request methods
Action API requests may use GET and POST methods. Prefer using the GET method, which allows requests to be routed to faster replica servers and responses to be cached, unless the length of the URL with parameters would exceed its length limit (commonly 8000 bytes), or a module only accepts POST requests.
Parameters for POST requests may be sent in the query part of the request URL (like in GET requests) and in the POST request body, and mixing both ways in one request is allowed. Certain parameters such as passwords must be sent in the request body. If the same parameter is sent as part of the URL and also in the request body, it must have the same value in both places.
Tîpi de dæto
L'input a MediaWiki o dêv'êse UTF-8 normalizòu NFC. MediaWiki o peu tentâ de convertî âtri input, ma quésto o poriéiva caxonâ o faliménto de çèrte òperaçioìn (c̟ómme modìfica con contròlli MD5).
I paràmetri che pîgian ciù valoî són de sòlito inviæ co-i valoî separæ do caràtere pipe, prezénpio param=value1|value2 ò param=value1%7Cvalue2. Se 'n valô o dêve contegnî 'n caràtere pipe, dêuviâ U+001F (Unit Separator) cómme separatô e prefìsso do valô U+001F, prezénpio param=%1Fvalue1%1Fvalue2.
Dötréi tîpi de paràmetri inte domànde API àn bezéugno de spiegaçioìn de ciùː
- boolean
'N paràmetro boleàn o fonçiónn-a cómme e cazélle de contròllo HTMLː se o paràmetro o l'é specificòu, indipendenteménte da-o valô, o l'é conscideròu vêo. Pe 'n valô fâso, òmétte do tùtto o paràmetro.
- expiry
I valoî de scadénsa poriéivan êse relatîvi (prezénpio 5 months ò 2 weeks) ò asolûti (prezénpio 2014-09-18T12:34:56Z). Pe nisciùnn-a scadénsa, dêuviâ infinite, indefinite, infinity ò never.
- timestamp
I timestamp pêuan êse scrîti inte vàrri formâti, védde a libràia di formâti de input di timestamp docomentâ in sce mediawiki.org pe-i detàggi. L'é consegiòu dæta e ténpo ISO 8601: 2001-01-15T14:56:00Z. Pe de ciù, a strìnca now a peu êse dêuviâ pe specificâ o timestamp corénte.
Limiti
Most API modules can accept up to 50 inputs in multivalue parameters, and can return up to 500 results per query (50 results for slow queries).
For users with the apihighlimits right (bot e Aministrador), the limits are increased to 500 inputs and 5 000 results (500 results for slow queries).
Paràmetri template
I paràmetri template supòrtan câxi inti quæ 'n mòdolo API o domànda 'n valô pe ògni valô de âtri paràmetri. Prezénpio, se ghe foîse 'n mòdolo API ch'o domànda frûto, o doviéiva avéi 'n paràmetro fruits pe specificâ quæ frûti són domandæ e 'n paràmetro template {fruit}-quantity pe specificâ quànti domandâ pe ògni frûto. 'N client API ch'o veu 1 méia, 5 banànn-e e 20 merélli o peu dónca fà 'na domànda cómme fruits=apples|bananas|strawberries&apples-quantity=1&bananas-quantity=5&strawberries-quantity=20.
Mòdolo prinçipâ
- Referénsaː MediaWiki
- Licénsaː GPL-2.0-or-later
Specify the action to perform, the format of the response, and options that apply to all API modules.
- action
Açión da conpî.
- abusefiltercheckmatch
- Controlla se un filtro anti abusi viene attivato da un insieme di variabili, una modifica o un evento nel registro abusi.
- abusefilterchecksyntax
- Verifica la sintassi di un filtro anti abusi.
- abusefilterevalexpression
- Valuta un'espressione del filtro anti abusi.
- abusefilterunblockautopromote
- Sblocca la possibilità di autopromozione a seguito di un blocco imposto dal filtro anti abusi.
- abuselogprivatedetails
- Visualizza i dettagli privati di una voce del registro anti abusi.
- acquiretempusername
- O pìggia 'n nómme uténte tenporànio e o-o ascónde inta seçión prezénte, si-â creaçión de 'n'uténsa tenporània a l'é permìssa e l'uténte prezénte o l'é desconésso. Se 'n ómme o l'é za stæto memorizòu, o-o restitoìsce pægio.
- antispoof
- Controlla un nome utente con le verifiche di normalizzazione AntiSpoof.
- block
- Blòcca 'n uténte.
- centralauthtoken
- Recupera un centralauthtoken per l'esecuzione di una richiesta autenticata a un wiki collegato.
- centralnoticecdncacheupdatebanner
- Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- Modificâ i dæti d'aotenticaçión pe l'uténte corénte.
- changecontentmodel
- Càngia o modéllo de contegnûo de 'na pàgina
- checktoken
- Verìfica a validitæ de 'n token da action=query&meta=tokens.
- clearhasmsg
- Scancélla o flag
hasmsgpe l'uténte corénte. - clientlogin
- Ìntra inta wiki dêuviàndo o flùsso interatîvo.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- Trêuva e diferénse tra dôe pàgine.
- createaccount
- Crêa 'na nêuva uténsa.
- createlocalaccount
- Forza la creazione di un'utenza locale. L'utenza centrale deve esistere.
- cxdelete
- Scancélla 'na bòssa de traduçión creâ dêuviàndo l'estensción Traduçión Contegnûi.
- cxtoken
- Òtêgne i token JWT pe l'outenticaçión con cxserver.
- delete
- Scancélla 'na pàgina.
- deleteglobalaccount
- Delete a global user.
- discussiontoolsedit
- Met foeura un messagg in su la pagina de discussion.
- discussiontoolsfindcomment
- Trova un commento tramite il suo ID o nome.
- discussiontoolsgetsubscriptions
- Oten i stat di sotoscrizzion de certi argoment.
- discussiontoolssubscribe
- Inscrives (o desiscrives) per ricever di notifiche sora un argoment.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Contrassegna tutte le notifiche come lette per l'utente attuale.
- echomarkseen
- Contrassegna le notifiche come viste per l'utente attuale.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Crêa e modìfica pàgine.
- editmassmessagelist
- Cànbia lista de consegna par mesaji masivi
- emailuser
- Mànda 'n mesàggio de pòsta eletrònica a 'n uténte.
- expandtemplates
- Espàndi tùtti i template into wikitèsto.
- featuredfeed
- Returns a featured content feed.
- feedcontributions
- Restitoìsce o feed di contribûti de 'n uténte.
- feedrecentchanges
- Restitoìsce 'n feed di ùrtimi cangiaménti.
- feedwatchlist
- Restitoìsce 'n feed da lìsta di òservæ speciâli.
- filerevert
- Riprìstina 'n file a 'na versción ciù vêgia.
- globalblock
- Blocca o sblocca globalmente un utente.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- Change global preferences of the current user.
- globaluserrights
- Add/remove a user to/from global groups.
- growthmanagementorlist
- Manage information in the structured mentor list (usually stored in MediaWiki:GrowthMentors.json). This module can be used by both current and future mentors (to add themselves or change their details) and administrators (for all users).
- growthmentordashboardupdatedata
- Schedule an extraordinary update of the mentee overview module in the mentor dashboard. You can only schedule one update per two hours for performance reasons.
- growthsetmenteestatus
- Set mentee's status (allows mentees to enable/disable mentorship module, or to opt-out entirely, which deletes the mentee/mentor relationship)
- growthsetmentor
- Imposta tutor dell'utente. Le modifiche verranno registrate pubblicamente.
- growthstarmentee
- Aggiungi o rimuovi un allievo dai preferiti dell'utenza attuale (salvati privatamente e non pubblicamente registrati)
- help
- Móstra a goìdda pe-i mòdoli specificæ.
- homepagequestionstore
- Ricevi domande formattate inviate tramite il modulo della pagina iniziale
- imagerotate
- Quésto mòdolo o l'é stæto dezabilitòu.
- import
- Inpòrta 'na pàgina da 'n'âtra wiki, òpû da 'n file XML.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Çèrca di nómmi de léngoe inte ògni arfabêto.
- linkaccount
- Colegaménto de 'n'uténsa de 'n provider de tèrse pàrte a l'uténte corénte.
- login
- Ìntra e òtêgni i cookie d'aotenticaçión.
- logout
- Sciòrti e scancélla i dæti da sesción.
- managetags
- Ezegoî i cónpiti de gestión relatîvi a-i tag de modìfica.
- massmessage
- Send a message to a list of pages.
- mergehistory
- O l'unìsce e cronologîe de pàgine.
- move
- Méscia 'na pàgina.
- opensearch
- Çèrca inta wiki dêuviàndo o protocòllo OpenSearch.
- options
- Càngia e preferénse de l'uténte corénte.
- paraminfo
- Òtêgni de informaçioìn in scî mòdoli API.
- parse
- Stùdia o contegnûo e restitoìsce l'output do parser.
- patrol
- Verificâ 'na pàgina ò versción.
- protect
- Modificâ o livéllo de proteçión de 'na pàgina.
- purge
- Netezâ a cache pe-i tìtoli indichæ.
- query
- Ricuperâ i dæti da e in sce MediaWiki.
- removeauthenticationdata
- O lêva i dæti d'aotenticaçión pe l'uténte corénte.
- resetpassword
- Mandâ 'n'emâi pe çèrne tórna a paròlla segrétta de 'n uténte.
- revisiondelete
- Scancélla ò riprìstina verscioìn.
- rollback
- Anulâ l'ùrtima modìfica a-a pàgina.
- rsd
- Esportâ 'n schêma RSD (Really Simple Discovery).
- setglobalaccountstatus
- Hide or lock (or unhide or unlock) a global user account.
- setnotificationtimestamp
- Agiornâ o timestamp de notìfica pe-e pàgine òservæ.
- setpagelanguage
- Cangiâ a léngoa de 'n pàgina.
- shortenurl
- Abbrevia un URL lungo in uno più corto.
- sitematrix
- Get Wikimedia sites list.
- spamblacklist
- Validate one or more URLs against the spam block list.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- Allows admins to strike or unstrike a vote.
- sxdelete
- Scancélla a bòssa de traduçión de seçión e i sò corpora paralêli da-a bànca dæti.
- tag
- Azónze ò levâ etichétte de modìfica da séncie verscioìn ò vôxe de regìstro.
- templatedata
- Repigiâ i dæti archiviæ da l'estensción TemplateData.
- thank
- Send a thank-you notification to an editor.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- torblock
- Check if an IP address is blocked as a Tor exit node.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- unblock
- Sblòcca 'n uténte.
- undelete
- Ripristinâ verscioìn de 'na pàgina scancelâ.
- unlinkaccount
- O lêva 'n'uténsa de tèrse pàrte conligâ a l'uténte corénte.
- upload
- Caregâ 'n file ò òtegnî o stâto di caregaménti in córso.
- userrights
- Cangiâ l'apartenénsa a 'n grùppo uténte.
- validatepassword
- Convalidâ 'na paròlla segrétta anàndo aprêuvo a-e polìtiche da wiki in scê paròlle segrétte.
- watch
- Levâ ò azónze de pàgine da-a lìsta di òservæ speciâli de l'uténte corénte.
- webapp-manifest
- O restitoìsce 'n manifèsto webapp.
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- bouncehandler
- Intèrno. Receive a bounce email and process it to handle the failing recipient.
- categorytree
- Intèrno. Modulo interno per l'estensione CategoryTree.
- chartinfo
- Intèrno. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- Intèrno. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Intèrno. Dump of CirrusSearch configuration.
- cirrus-profiles-dump
- Intèrno. Copia dei profili di CirrusSearch per questo wiki.
- cirrus-schema-dump
- Intèrno. Dump of CirrusSearch schema (settings and mappings) for this wiki.
- codemirror-validate
- Intèrno. Check for validation errors in the given content
- collection
- Intèrno. Sotmodulo per fà diverse operazzion in su ona racolta d'on utent wiki.
- cspreport
- Intèrno. Dêuviòu da-o motô de riçèrca pe segnalâ de violaçioìn da polìtica de seguéssa di contegnûi. Sto mòdolo chi o no va mâi dêuviòu, a eceçión di câxi inti quæ o ségge dêuviòu outomaticaménte da 'n motô de riçèrca confórme a CSP.
- cxcheckunreviewed
- Intèrno. Contròlla se da l'uténte prezénte l'é stæto pubricòu che no l'é goæi de traduçioìn a-a spedîa e no revixonæ.
- cxfavoritesuggestions
- Intèrno. Azónzi ò lêva un di conséggi preferîi da-a lìsta de l'uténte prezénte
- cxpublish
- Intèrno. Sàrva 'na pàgina creâ pe mêzo de l'estensción Traduçión Contegnûi.
- cxpublishsection
- Intèrno. Sàrva 'na seçión creâ dêuviàndo a fonçión de traduçión de seçioìn de l'estenscón Traduçión Contegnûi.
- cxsave
- Intèrno. Sto mòdolo chi o permétte de sarvâ de bòsse de traduçioìn pe seçión pe sarvâ a larghéssa de bànda e p'arechéugge i corpora paralêli.
- cxsplit
- Intèrno. Crêa e sàrva 'na traduçión de seçión inta bànca dæti, pe ògni seçión tradûta da traduçión da pàgina indicâ
- discussiontoolscompare
- Intèrno. Oten di informazzion sora i cambiament ai coment in fra du revision de la pagina.
- discussiontoolspageinfo
- Intèrno. El dà indree a i metadati che gh'è besogn per dagh l'inviada ai instrument de discussion.
- discussiontoolspreview
- Intèrno. Preview a message on a discussion page.
- echopushsubscriptions
- Intèrno. Manage push subscriptions for the current user.
- editcheckreferenceurl
- Intèrno. Check the status of a URL for use as a reference.
- fancycaptchareload
- Intèrno. Ottieni un nuovo FancyCaptcha.
- growthinvalidateimagerecommendation
- Intèrno. Invalidate an image recommendation.
- growthinvalidatepersonalizedpraisesuggestion
- Intèrno. Invalidates a suggestion of a praiseworthy mentee in the Personalized praise module on the Mentor dashboard
- growthinvalidaterevisetonerecommendation
- Intèrno. Drop a 'Revise Tone' recommendation for a given page.
- helppanelquestionposter
- Intèrno. Gestisci domande inviate tramite il pannello introduttivo dall'attuale utente.
- jsondata
- Intèrno. Retrieve localized JSON data.
- jsontransform
- Intèrno. Retrieve JSON data transformed by a Lua function.
- parser-migration
- Intèrno. Analizza una pagina con due diverse configurazioni di parser.
- readinglists
- Intèrno. Reading list write operations.
- sanitize-mapdata
- Intèrno. O fà a validaçión di dæti pe l'estensción Kartographer
- scribunto-console
- Intèrno. Internal module for servicing XHR requests from the Scribunto console.
- securepollauth
- Intèrno. Allows a remote wiki to authenticate users before granting access to vote in the election.
- stashedit
- Intèrno. Preparâ 'na modìfica inta cache condivîza.
- sxsave
- Intèrno. Sàrva a bòssa de traduçión de seçión e depòxitala inti corpora paralêli
- timedtext
- Intèrno. Provides timed text content for usage by <track> elements
- ulslocalization
- Intèrno. Get the localization of ULS in the given language.
- ulssetlang
- Intèrno. Update user's preferred interface language.
- visualeditor
- Intèrno. O restitoìsce HTML5 pe 'na pàgina do servìçio Parsoid.
- visualeditoredit
- Intèrno. Sàrva 'na pàgina HTML5 inte MediaWiki (convertîa inte wikitèsto pe mêzo do servìçio Parsoid).
- wikimediaeventsblockededit
- Intèrno. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Intèrno. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- Un di valoî chi de sótta: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, cxdelete, cxtoken, delete, deleteglobalaccount, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, growthmanagementorlist, growthmentordashboardupdatedata, growthsetmenteestatus, growthsetmentor, growthstarmentee, help, homepagequestionstore, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, massmessage, mergehistory, move, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, streamconfigs, strikevote, sxdelete, tag, templatedata, thank, titleblacklist, torblock, transcodereset, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, codemirror-validate, collection, cspreport, cxcheckunreviewed, cxfavoritesuggestions, cxpublish, cxpublishsection, cxsave, cxsplit, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, echopushsubscriptions, editcheckreferenceurl, fancycaptchareload, growthinvalidateimagerecommendation, growthinvalidatepersonalizedpraisesuggestion, growthinvalidaterevisetonerecommendation, helppanelquestionposter, jsondata, jsontransform, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, sxsave, timedtext, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
- Predefinîo: help
- format
Formâto de l'output.
- json
- Dæti de output into formâto JSON.
- jsonfm
- Dæti de output into formâto JSON (bén formatòu in HTML).
- none
- Nisciùn output.
- php
- Dæti de output into formâto in série PHP.
- phpfm
- Dæti de output into formâto in série PHP (bén formatòu in HTML).
- rawfm
- Dæti de output, inclûxi i eleménti de debug, into formâto JSON (bén formatòu in HTML).
- xml
- Dæti de output into formâto XML.
- xmlfm
- Dæti de output into formâto XML (bén formatòu in HTML).
- Un di valoî chi de sótta: json, jsonfm, none, php, phpfm, rawfm, xml, xmlfm
- Predefinîo: jsonfm
- maxlag
O màscimo ritàrdo o pêu êse dêuviòu quànde MediaWiki o l'é instalòu in sce 'n database replicated cluster. Pe sarvâ e açioìn che càozan ciù ritàrdo inta réplica do scîto, quésto paràmetro o pêu fâ de mòddo che o client o l'aspêta scìnn-a quànde o ritàrdo da réplica o ségge inferiô a-o valô specificòu. In câxo de ritàrdo ecescîvo, o còdice d'erô maxlag o l'é restitoîo co-in mesàggio cómme Waiting for $host: $lag seconds lagged.
Védde Manual: Maxlag parameter pe ciù informaçioìn.- Tîpo: intrêgo
- smaxage
Inpòsta l'intestaçión do contròllo da cache HTTP
s-maxagein sce sto nùmero de segóndi chi. I eroî no són memorizæ inta cache.- Tîpo: intrêgo
- O valô no gh'àn da êse ciù picìn de 0.
- Predefinîo: 0
- maxage
Inpòsta l'intestaçión do contròllo da cache HTTP
max-agein sce sto nùmero de segóndi chi. I eroî no són memorizæ inta cache.- Tîpo: intrêgo
- O valô no gh'àn da êse ciù picìn de 0.
- Predefinîo: 0
- assert
Verìfica che l'uténte o l'àgge efetoòu l'intrâ (inclûzo se cómme uténte tenporànio) se s'é inpostòu user, no l'àgge efetoòu l'intrâ se s'é inpostòu anon ò ch'o l'àgge i permìsci de bot se s'é inpostòu bot.
- Un di valoî chi de sótta: anon, bot, user
- assertuser
Verìfica che l'uténte corénte o ségge l'uténte dezignòu.
- Tipo: utent, per mezz de quaivoeuna di nom de l'utent e Uténte tenporànio
- requestid
Tùtti i valoî fornîi saiàn inclûzi inta rispòsta. Poriéivan êse dêuviæ pe distìngoe e domànde.
- servedby
Inclùddi into rizultâto o nómme de l'host ch'o l'à servîo a domànda.
- Tîpoː boleàn (detàggi)
- curtimestamp
Inclùddi into rizultâto o timestamp atoâle.
- Tîpoː boleàn (detàggi)
- responselanginfo
Inclùddi e léngoe dêuviæ pe uselang e errorlang into rizultâto.
- Tîpoː boleàn (detàggi)
- origin
Quànde ti ti gh'intri inte l'API dêuviàndo 'na cross-domain AJAX request (CORS), seleçionâla a-o domìnio òriginâle. Quésto o dêve êse fæto inte ògni domànda pre-flight, e dónca o dêve êse pàrte da domànda URI (e no do córpo POST).
Pe domànde outenticæ, quésto o dêve coincìdde co-ina de òrìgine into tìtolo
Origin, dónca o dêve inpostòu ciù ò mêno cómme https://en.wikipedia.org ò https://meta.wikimedia.org. Se sto paràmetro chi o no coincìdde co-o tìtoloOrigin, a rispòsta a saiâ 'n erô 403. Se sto paràmetro chi o coincìdde co-o tìtoloOrigin, e l'òrigine a l'é permìssa, i tìtoli code>Access-Control-Allow-Origin eAccess-Control-Allow-Credentialssaiàn mostræ.Pe domànde no outenticæ, specificâ o valô *. Quésto o portiâ a mostrâ o tìtolo
Access-Control-Allow-Origin, maAccess-Control-Allow-Credentialso saiâfalsee tùtti i dæti specìfichi de l'uténte saiàn limitæ.- crossorigin
Quànde s'ìntra inte l'API pe mêzo de 'na cross-domain AJAX request (CORS) e pe mêzo de 'n fornitô de sescioìn ch'o l'é segûo cóntra i atàcchi cross-site request forgery (CSRF), cómme OAuth, dêuviælo in càngio de
origin=*pe outenticâ a domànda, e dónca pe no disconétila. Quésto o gh'à da êse inclûzo inte ògni domànda de pre-flight, e dónca o gh'à da fâ pàrte de l'URI da domànda (no o còrpo POST).Tegnî prezénte che a ciù pàrte di fornitoî de sescioìn, conpréizo e sescioìn stàndard bazæ in scî cookie, no supòrtan CORS outenticæ e no pêuan êse dêuviæ con sto paràmetro chi.
- Tîpoː boleàn (detàggi)
- uselang
Léngoa da dêuviâ inta traduçión di mesàggi. action=query&meta=siteinfo&siprop=languages con siprop=languages o restitoìsce 'na lìsta de còdichi de léngoe. Ti peu specificâ user pe dêuviâ e preferénse lengoìstiche prezénti de l'uténte ò content pe dêuviâ a léngoa di contegnûi de sta wiki chi.
- Predefinîo: user
- variant
Variànte da léngoa. O fonçiónn-a sôlo se a léngoa de bâze a supòrta a conversción de vàriante.
- errorformat
Formâto da dêuviâ pe-i tèsti de avîso ò de erô
- plaintext
- Wikitèsto con tag HTML levæ e entitæ sostitoîe.
- wikitext
- Wikitèsto no analizòu.
- html
- HTML
- raw
- Ciâve di mesàggi e paràmetri.
- none
- Nisciùn tèsto in sciortîa, sôlo còdichi d'erô.
- bc
- Formâto dêuviòu prìmma de MediaWiki 1.29. errorlang e errorsuselocal són ignoræ.
- Un di valoî chi de sótta: bc, html, none, plaintext, raw, wikitext
- Predefinîo: bc
- errorlang
Léngoa da dêuviâ pe mesàggi d'avîso e d'erô. action=query&meta=siteinfo&siprop=languages con siprop=languages o restitoìsce 'na lìsta de còdichi de léngoe. Ti peu specificâ content pe dêuviâ a léngoa di contegnûi de sta wiki chi ò uselang pe dêuviâ o mæximo valô do paràmetro uselang.
- Predefinîo: uselang
- errorsuselocal
Se inpostòu, o tèsto d'erô de sòlito o mostriâ di mesàggi inpostæ localménte into namespace MediaWiki.
- Tîpoː boleàn (detàggi)
- centralauthtoken
When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after 60 seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).
On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.
- Agiùtto pe-o mòdolo prinçipâ.
- api.php?action=help [arvî inte 'na sandbox]
- Tùtti i agiùtti inte 'na pàgina.
- api.php?action=help&recursivesubmodules=1&toc [arvî inte 'na sandbox]
Créditi
Svilupatoî de API
- Yuri Astrakhan (creatô, svilupatô càppo Set 2006–Set 2007)
- Roan Kattouw (svilupatô càppo Set 2007–2009)
- Victor Vasiliev
- Bryan Tong Minh
- Sam Reed
- Brad Jorsch (svilupatô càppo 2013–2020)
Pe piâxéi mànda i tò coménti, drîte e domànde a l'indirìsso [email protected] ò, pe segnalâ di bug, a https://phabricator.wikimedia.org/.
